DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arl4d

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_079680.1 Gene:Arl4d / 80981 MGIID:1933155 Length:201 Species:Mus musculus


Alignment Length:185 Identity:53/185 - (28%)
Similarity:95/185 - (51%) Gaps:14/185 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILVLGLNNSGKSSIINHFK-KSSEQTSIVVPTVGFMVEQFYI---GMSGVSIKAIDMSGATRYRN 80
            ::|:||:::||:|::...| |...|:   |||.||..|:..:   |..|::.:..|:.|..:.|.
Mouse    24 VVVIGLDSAGKTSLLYRLKFKEFVQS---VPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRP 85

  Fly    81 LWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKI 145
            ||....:...|:::|:||::..|....:.||..:.:..|  |:.||:|...||.|...:||:.::
Mouse    86 LWRSYTRRTDGLVFVVDSAETERLEEARMELHRISKASD--NQGVPVLVLANKQDQPGALSAAEV 148

  Fly   146 AAALRLENIKDKP-WHICSSSAISGEGLGEGVQWLIQQMRFAMLNNKNAAKSRSK 199
            ...|.:..:.... .|:...||:.|.||..|::.|.:.    :|..|.|.:|..|
Mouse   149 EKRLAVRELAAATLTHVQGCSAVDGLGLQPGLEHLYEM----ILKRKKAPRSSKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 48/166 (29%)
Arl4dNP_079680.1 Arl4_Arl7 19..201 CDD:206719 53/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.