DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and ARL14

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_079323.1 Gene:ARL14 / 80117 HGNCID:22974 Length:192 Species:Homo sapiens


Alignment Length:161 Identity:48/161 - (29%)
Similarity:96/161 - (59%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNLWEH 84
            :|:|||:::|||:::...|.:.:.|:|  ||:||.||...:..: :|:...|:.|..:.|.:|..
Human    16 VLLLGLDSAGKSTLLYKLKLAKDITTI--PTIGFNVEMIELERN-LSLTVWDVGGQEKMRTVWGC 77

  Fly    85 QFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIAAAL 149
            ..:|..|::||:||:|:.|....:.:.:.:|::..:.|  ||::...||.||..:|::..|....
Human    78 YCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKN--VPVVLLANKQDMPGALTAEDITRMF 140

  Fly   150 RLENI-KDKPWHICSSSAISGEGLGEGVQWL 179
            :::.: .|:.|::....|::||||.:|.:.|
Human   141 KVKKLCSDRNWYVQPCCALTGEGLAQGFRKL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 48/161 (30%)
ARL14NP_079323.1 SAR 1..175 CDD:197556 48/161 (30%)
ARLTS1 15..174 CDD:133356 48/161 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.