DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arl2

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_006230961.1 Gene:Arl2 / 65142 RGDID:69326 Length:210 Species:Rattus norvegicus


Alignment Length:207 Identity:58/207 - (28%)
Similarity:103/207 - (49%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGV 65
            ||:| .:...:|.|:.::.:|:|||:|:||::|:..|  :.|....:.||:||.::.  :...|.
  Rat     1 MGLL-TILKKMKQKERELRLLMLGLDNAGKTTILKKF--NGEDVDTISPTLGFNIKT--LEHRGF 60

  Fly    66 SIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVL----------QHPDL 120
            .:...|:.|....|:.|.:.|::..|:|:|:||:||.|....:.||..:|          .....
  Rat    61 KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEEVCPVLTGSQATA 125

  Fly   121 CNRI--------------VPILFYGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEG 171
            |::.              ..:|.:.||.|:..:||...|..||.|::|:...|.|...||::||.
  Rat   126 CHKCHGLLGHSGRERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGED 190

  Fly   172 LGEGVQWLIQQM 183
            |..|:.||:..:
  Rat   191 LLPGIDWLLDDI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 53/186 (28%)
Arl2XP_006230961.1 Arl2 3..201 CDD:206720 56/202 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.