DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arl1

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_071780.1 Gene:Arl1 / 64187 RGDID:621326 Length:181 Species:Rattus norvegicus


Alignment Length:168 Identity:58/168 - (34%)
Similarity:96/168 - (57%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNL 81
            :|.||:|||:.:||::|:...:.....|:|  ||:||.||.  :....:..:..|:.|.|..|..
  Rat    17 EMRILILGLDGAGKTTILYRLQVGEVVTTI--PTIGFNVET--VTYKNLKFQVWDLGGQTSIRPY 77

  Fly    82 WEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIA 146
            |...:.|...:|||:||.||.|..:.|.||..:|:..:|...|  ::.:.||.|||.:::..::|
  Rat    78 WRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAI--LVVFANKQDMEQAMTPSEMA 140

  Fly   147 AALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184
            .||.|..:||:.|.|..:||..|.||.|.::||::.::
  Rat   141 NALGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 57/162 (35%)
Arl1NP_071780.1 Arl1 19..176 CDD:206718 57/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.