DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arl4ca

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001017749.1 Gene:arl4ca / 550444 ZFINID:ZDB-GENE-050417-265 Length:192 Species:Danio rerio


Alignment Length:184 Identity:56/184 - (30%)
Similarity:94/184 - (51%) Gaps:12/184 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIG---MSGVSIKAIDMSGATRYRNL 81
            |::|||:::||::::...|.:....:  |||:||..|:..:.   ..|:|....|:.|..:.|.|
Zfish    16 IVMLGLDSAGKTTVLYRLKFNEFVNT--VPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPL 78

  Fly    82 WEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIA 146
            |:...:...|||||:||.|..|....|.||..|.:..:  |:..|:|...||.|:..||:..:|.
Zfish    79 WKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAE--NQGTPLLVIANKQDLPKSLTVSEIE 141

  Fly   147 AALRLENIK-DKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNKNAAKSRSK 199
            ..|.|..:. ...:|:..:.||.||||.||:..|.:.    ::..:.:.|.:.|
Zfish   142 KHLALHELSPSTTYHVQPACAIIGEGLHEGMDKLYEM----IVKRRKSLKQKKK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 54/165 (33%)
arl4caNP_001017749.1 Arl4_Arl7 11..192 CDD:206719 56/184 (30%)
small_GTP 16..181 CDD:272973 54/172 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.