DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arl6

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_021329928.1 Gene:arl6 / 494134 ZFINID:ZDB-GENE-041219-2 Length:194 Species:Danio rerio


Alignment Length:196 Identity:100/196 - (51%)
Similarity:139/196 - (70%) Gaps:2/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGV 65
            ||:...||..:.:||.::.:|.|||:||||::|||..|.|:.|...:|||:||.:|:|  ..|.:
Zfish     1 MGLFDKLAGWLGLKKKEVNVLCLGLDNSGKTTIINQLKPSNAQAQDIVPTIGFSIEKF--KTSSL 63

  Fly    66 SIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFY 130
            |....||||..||||||||.:|....||:||||.|::|.||.|:|||.:|.|||:.:|.:|:||:
Zfish    64 SFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSGDKLRMVVAKEELDTLLNHPDIKHRRIPLLFF 128

  Fly   131 GNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNKNAAK 195
            .||||:.|:||:||::..|.||||||||||||:|.|:.||||.|||.||.:|:..:..:::|...
Zfish   129 ANKMDLRDALSAVKVSQLLCLENIKDKPWHICASDAVKGEGLLEGVDWLQEQIALSNQSDENVKP 193

  Fly   196 S 196
            |
Zfish   194 S 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 91/162 (56%)
arl6XP_021329928.1 Arl6 19..180 CDD:206722 91/162 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592013
Domainoid 1 1.000 200 1.000 Domainoid score I2992
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12960
Inparanoid 1 1.050 209 1.000 Inparanoid score I3660
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0007847
OrthoInspector 1 1.000 - - oto38635
orthoMCL 1 0.900 - - OOG6_105712
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2408
SonicParanoid 1 1.000 - - X5803
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.