DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arl4

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001245408.1 Gene:Arl4 / 43771 FlyBaseID:FBgn0039889 Length:313 Species:Drosophila melanogaster


Alignment Length:217 Identity:56/217 - (25%)
Similarity:105/217 - (48%) Gaps:28/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVE--QFYIGMS-GVSI 67
            |:.|.:..:...:.:::|||:::||::.:  ::...:|....|||:||..|  |..:|.: ||..
  Fly    14 NILDALPSQVATLHVVMLGLDSAGKTTAL--YRLKFDQYLNTVPTIGFNCEKVQCTLGKAKGVHF 76

  Fly    68 KAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGN 132
            ...|:.|..:.|.||....:...||::||||.|..|....|.||....:.||  |:.||:|...|
  Fly    77 LVWDVGGQEKLRPLWRSYTRCTDGILFVIDSVDTERMEEAKMELMRTAKCPD--NQGVPVLILAN 139

  Fly   133 KMDMEDSLSSVKIAAALRLENIKDKPWHI----------------C--SSSAISGEGLGEGVQWL 179
            |.|:.::..::::...|.|..:.:...:|                |  |:.:|:.:.|.|..:  
  Fly   140 KQDLPNACGAMELEKLLGLNELYNPVPNISMPSSSDSSPTINLIGCRVSNQSITDKSLEEKKE-- 202

  Fly   180 IQQMRFAMLNNKNAAKSRSKHS 201
             ..:..:|::.|.|.:|:..:|
  Fly   203 -SHLHSSMIHIKPALESKDHNS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 49/183 (27%)
Arl4NP_001245408.1 P-loop_NTPase 24..311 CDD:304359 54/207 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455851
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.