DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arl1

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_524098.2 Gene:Arl1 / 39745 FlyBaseID:FBgn0000115 Length:180 Species:Drosophila melanogaster


Alignment Length:163 Identity:60/163 - (36%)
Similarity:95/163 - (58%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNL 81
            :|.||:|||:.:||::|:...:.....|:|  ||:||.|||  :....:..:..|:.|.|..|..
  Fly    16 EMRILILGLDGAGKTTILYRLQVGEVVTTI--PTIGFNVEQ--VTYKNLKFQVWDLGGQTSIRPY 76

  Fly    82 WEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIA 146
            |...:.|...||||:||:||.|..:.||||..:|:..:|...|:.:|  .||.||:..::..::.
  Fly    77 WRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVL--ANKQDMDGCMTVAEVH 139

  Fly   147 AALRLENIKDKPWHICSSSAISGEGLGEGVQWL 179
            .||.|||:|::.:.|..:||..||||.:.:.||
  Fly   140 HALGLENLKNRTFQIFKTSATKGEGLDQAMDWL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 59/161 (37%)
Arl1NP_524098.2 Arl1 18..175 CDD:206718 59/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.