DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arl10

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_989044.1 Gene:arl10 / 394641 XenbaseID:XB-GENE-945631 Length:237 Species:Xenopus tropicalis


Alignment Length:184 Identity:56/184 - (30%)
Similarity:95/184 - (51%) Gaps:11/184 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNLWEH 84
            ||||||:.:||||||:....::.::| ..||.||...|  |...|:.|:.:::.|:...|..|..
 Frog    48 ILVLGLDGAGKSSIIHAISTNTTRSS-SAPTHGFNSAQ--IIHQGLRIELLEVGGSQNLRTYWSQ 109

  Fly    85 QFKNCHGIIYVIDSSDRMRFVVVKDELDLVL-QHPDLCNRIVPILFYGNKMDMEDSLSSVKIAAA 148
            ..||.:.|::|:||:|..|..:.:.||..:| :.|||     |::...||.|...:|...:|.:.
 Frog   110 YLKNANVIVFVVDSTDNKRLHLARQELHRLLHEAPDL-----PLMVLANKQDQNTALCLPEIHSE 169

  Fly   149 LRLENIK-DKPWHICSSSAIS-GEGLGEGVQWLIQQMRFAMLNNKNAAKSRSKH 200
            |.|..|. ::...:..:||:| |.|....:|.:...:...:...|..|::.:.|
 Frog   170 LSLHRITGEREVTLLGTSAVSDGAGHSTRLQTVKTLLEERLHRPKGPAQNGANH 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 53/164 (32%)
arl10NP_989044.1 P-loop_NTPase 47..210 CDD:328724 53/169 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.