DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arf5

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_989018.1 Gene:arf5 / 394614 XenbaseID:XB-GENE-968852 Length:181 Species:Xenopus tropicalis


Alignment Length:186 Identity:65/186 - (34%)
Similarity:109/186 - (58%) Gaps:12/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ADLIK--IKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAI 70
            |:|.|  ..|.:|.||::||:.:||::|:...|.....|:|  ||:||.||.  :....:|....
 Frog     6 ANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTI--PTIGFNVET--VEYKNISFTVW 66

  Fly    71 DMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMD 135
            |:.|..:.|.||.|.|:|..|:|:|:||:||.|....::||..:|...:|  |...:|.:.||.|
 Frog    67 DVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDEL--RDAVLLVFANKQD 129

  Fly   136 MEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNK 191
            :.:::::.:|...|.|.:::.:.|:|.::.|.||:||.||:.||..|:|    |:|
 Frog   130 LPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR----NHK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 56/162 (35%)
arf5NP_989018.1 ARF 5..179 CDD:128474 63/182 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.