DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arl3l2

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_957013.1 Gene:arl3l2 / 393692 ZFINID:ZDB-GENE-040426-1678 Length:187 Species:Danio rerio


Alignment Length:190 Identity:58/190 - (30%)
Similarity:105/190 - (55%) Gaps:10/190 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVS 66
            |:|..:..|....:.::.||:|||:|:||::::...  :||..:.:.||.||.::.  :...|:.
Zfish     7 GLLSVMQKLKGSSELELRILLLGLDNAGKTTLLKSL--ASEDVNTITPTQGFNIKT--VASRGMK 67

  Fly    67 IKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYG 131
            :...|:.|..:.|..|:...:|...::|||||:|:.||.....||..::...:||.  ||:|.:.
Zfish    68 LNVWDIGGQRKIRPFWKKYLENTDLLVYVIDSADKKRFEETGLELSELIDEENLCG--VPVLIFA 130

  Fly   132 NKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNK 191
            ||.|:..:..:.:||..|.|...:|:.|.|.:.|||:|||:.:|:.|:...    ::|.|
Zfish   131 NKQDLGTAAPASEIAEGLNLHTYRDRVWQIQACSAITGEGVQDGMNWICNN----LVNRK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 53/162 (33%)
arl3l2NP_957013.1 Arl3 8..181 CDD:206721 55/178 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.