DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and ARF1

DIOPT Version :10

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001649.1 Gene:ARF1 / 375 HGNCID:652 Length:181 Species:Homo sapiens


Alignment Length:186 Identity:65/186 - (34%)
Similarity:109/186 - (58%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIK--IKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMS 63
            ||.:  .|:|.|  ..|.:|.||::||:.:||::|:...|.....|:|  ||:||.||.  :...
Human     1 MGNI--FANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTI--PTIGFNVET--VEYK 59

  Fly    64 GVSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPIL 128
            .:|....|:.|..:.|.||.|.|:|..|:|:|:||:||.|....::||..:|...:|  |...:|
Human    60 NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDEL--RDAVLL 122

  Fly   129 FYGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184
            .:.||.|:.:::::.:|...|.|.:::.:.|:|.::.|.||:||.||:.||..|:|
Human   123 VFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 56/162 (35%)
ARF1NP_001649.1 Important for the stable binding to the membranes. /evidence=ECO:0000250|UniProtKB:P84080 3..16 3/14 (21%)
ARF 5..179 CDD:128474 63/180 (35%)

Return to query results.
Submit another query.