DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arf3b

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001012248.1 Gene:arf3b / 368822 ZFINID:ZDB-GENE-030616-356 Length:181 Species:Danio rerio


Alignment Length:186 Identity:64/186 - (34%)
Similarity:110/186 - (59%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIK--IKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMS 63
            ||.:  ..:|:|  |.|.:|.||::||:.:||::|:...|.....|:|  ||:||.||.  :...
Zfish     1 MGNI--FGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTI--PTIGFNVET--VEYK 59

  Fly    64 GVSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPIL 128
            .:|....|:.|..:.|.||.|.|:|..|:|:|:||:||.|....::||..:|...:|  |...:|
Zfish    60 NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDEL--RDAVLL 122

  Fly   129 FYGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184
            .:.||.|:.:::::.:|...|.|.:::.:.|:|.::.|.||:||.||:.||..|::
Zfish   123 VFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 56/162 (35%)
arf3bNP_001012248.1 P-loop_NTPase 5..179 CDD:422963 62/180 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.