DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arf51F

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_523751.2 Gene:Arf51F / 36699 FlyBaseID:FBgn0013750 Length:175 Species:Drosophila melanogaster


Alignment Length:180 Identity:64/180 - (35%)
Similarity:99/180 - (55%) Gaps:12/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIKIKKDK-MTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSG 64
            ||.|     |.||..:| |.||:|||:.:||::|:  :|....|:...:|||||.||.  :....
  Fly     1 MGKL-----LSKIFGNKEMRILMLGLDAAGKTTIL--YKLKLGQSVTTIPTVGFNVET--VTYKN 56

  Fly    65 VSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILF 129
            |.....|:.|..:.|.||.|.:....|:|:|:|.:||.|....:.||..::...::.:.|  ||.
  Fly    57 VKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAI--ILI 119

  Fly   130 YGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWL 179
            :.||.|:.|::...:|...|.|..|:|:.|::..|.|.||:||.||:.||
  Fly   120 FANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 56/161 (35%)
Arf51FNP_523751.2 P-loop_NTPase 1..174 CDD:422963 64/180 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11711
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.