DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arl11

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001013451.1 Gene:Arl11 / 364396 RGDID:1308083 Length:173 Species:Rattus norvegicus


Alignment Length:168 Identity:55/168 - (32%)
Similarity:91/168 - (54%) Gaps:5/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYRNL 81
            |..:::|||:.:||::|:  :|....:....:|||||.||... ....||:...|:.|.|:.|..
  Rat    10 KAQVVMLGLDCAGKTTIL--YKLKGNRLVDTLPTVGFNVEPLE-APGHVSLTLWDIGGQTQLRAT 71

  Fly    82 WEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKIA 146
            |:...:....::||:||:|..|......||:.||:.|::..  ||.|...||.:..|:|..::|.
  Rat    72 WKDYLEGIDLLVYVLDSTDEARLPEAVAELEEVLEDPNMAG--VPFLVLANKQEAPDALPLLEIR 134

  Fly   147 AALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184
            ..|.||..:|..|.:.:.||::|:||.|..|.|:..:|
  Rat   135 NRLDLERFQDHCWELRACSALTGQGLQEARQSLLHLLR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 53/162 (33%)
Arl11NP_001013451.1 P-loop_NTPase 12..167 CDD:304359 52/159 (33%)
Ras 13..172 CDD:278499 53/163 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.