DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Arl6

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_006248253.1 Gene:Arl6 / 363760 RGDID:1305535 Length:193 Species:Rattus norvegicus


Alignment Length:179 Identity:98/179 - (54%)
Similarity:134/179 - (74%) Gaps:2/179 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGV 65
            ||:|..|:.|:.:||.::.:|.|||:||||::|||..|.|:.|...:|||:||.:|:|  ..|.:
  Rat     1 MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQVQDIVPTIGFSIEKF--KSSSL 63

  Fly    66 SIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFY 130
            |....||||..||||||||.:|:...||:|:||||::|.||.|:|||.:|.|||:.:|.:||||:
  Rat    64 SFTVFDMSGQGRYRNLWEHYYKDGQAIIFVVDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFF 128

  Fly   131 GNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWL 179
            .||||:.|:::|||::..|.||||||||||||:|.|:.||||.|||.||
  Rat   129 ANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDALKGEGLQEGVDWL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 91/161 (57%)
Arl6XP_006248253.1 SAR 11..179 CDD:197556 91/167 (54%)
Arl6 19..180 CDD:206722 91/161 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350325
Domainoid 1 1.000 200 1.000 Domainoid score I2955
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12960
Inparanoid 1 1.050 210 1.000 Inparanoid score I3598
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 1 1.000 - - FOG0007847
OrthoInspector 1 1.000 - - oto96571
orthoMCL 1 0.900 - - OOG6_105712
Panther 1 1.100 - - LDO PTHR11711
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5803
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.