DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and CG13692

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster


Alignment Length:193 Identity:41/193 - (21%)
Similarity:77/193 - (39%) Gaps:37/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TILVLGLNNSGKSSIINHFK--KSSEQTSIVVPTVGFMVEQFYIGMSG----------------- 64
            |.:.||...:||:.::...:  :|.::|:..:||:|..:.:.:.....                 
  Fly     3 TCICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKSPNGDKNKPPPSEAPANI 67

  Fly    65 --------VSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLC 121
                    .||:.:::.|:  ...||...|::...:|||:|:|:..:..........:|..|.|.
  Fly    68 PHGGKNLPKSIQILEIGGS--MAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSILTEPRLQ 130

  Fly   122 NRIVPILFYGNKMDMEDSLSSVKIAAALRLENIK-----DKPWHICSSSAISGEGLGEGVQWL 179
            :. ..||....|||.  |...::..|.|.|:..|     .:...|..:||::..||.....||
  Fly   131 HN-TKILLVLAKMDY--SYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 41/193 (21%)
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 40/192 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.