DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arl4d

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_955938.1 Gene:arl4d / 323573 ZFINID:ZDB-GENE-030131-2293 Length:200 Species:Danio rerio


Alignment Length:181 Identity:47/181 - (25%)
Similarity:94/181 - (51%) Gaps:14/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILVLGLNNSGKSSIINHFK-KSSEQTSIVVPTVGFMVEQFYIGMS---GVSIKAIDMSGATRYRN 80
            ::|:||::|||:|::...| |...:|   :||.||..|:..:.:.   .::.:|.|:.|..:.|.
Zfish    23 VVVIGLDSSGKTSLLYRLKLKEFVET---IPTKGFNTEKIKVPVGNGRAITFQAWDVGGQEKLRP 84

  Fly    81 LWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVKI 145
            ||:...:...|:::|:||::..|....|.||..:.:..:  |:.||:|...||.|:..:|....:
Zfish    85 LWKSYTRRTDGMVFVVDSTEVERMEEAKVELHKITRTSE--NQGVPVLVLANKQDLPVALPVSDV 147

  Fly   146 AAALRLENIKDKP-WHICSSSAISGEGLGEGVQ----WLIQQMRFAMLNNK 191
            ...|.:..:.... .|:...||:.|:||..|::    .::::.:...|:.|
Zfish   148 EKVLAVHELSASTLHHVQGCSAVDGQGLQLGLEKLYDMILKRKKMVRLSKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 45/170 (26%)
arl4dNP_955938.1 Arl4_Arl7 18..200 CDD:206719 47/181 (26%)
small_GTP 23..188 CDD:272973 45/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.