DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and Y54E10BR.2

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_491094.1 Gene:Y54E10BR.2 / 171878 WormBaseID:WBGene00021841 Length:191 Species:Caenorhabditis elegans


Alignment Length:176 Identity:39/176 - (22%)
Similarity:85/176 - (48%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKDKMTILVLGLNNSGKSSII----NHFKKSSE--QTSIVVPTVGFMVEQFYIGMSGVSIKAIDM 72
            ||....::::||:|:||::.:    :||.|...  ..|.:..|||.....  :.::...:...|:
 Worm    14 KKKDYYVVIVGLDNAGKTTFLEQTKSHFVKDYGVLNPSKITATVGLNTGN--VELNNTCLHFWDL 76

  Fly    73 SGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDME 137
            .|....|.||...:.:.:.:|:|:|::....|.:|..:...|:.:..:.|  :|:|...||.:||
 Worm    77 GGQESLRELWATYYDDANAMIFVVDATRSDLFPIVASQFKEVMANEIVQN--IPVLVAVNKSEME 139

  Fly   138 DSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQM 183
            .:.::.::...|..:|.: ....:...||:.|..:...|.|:::.:
 Worm   140 GAAAAAEVRMLLEDDNHR-SDLAVLPVSALEGTNIERCVHWIVRSL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 37/168 (22%)
Y54E10BR.2NP_491094.1 small_GTP 17..174 CDD:272973 35/161 (22%)
Arfrp1 19..183 CDD:206725 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.