DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and ARL9

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001350723.1 Gene:ARL9 / 132946 HGNCID:23592 Length:265 Species:Homo sapiens


Alignment Length:142 Identity:41/142 - (28%)
Similarity:73/142 - (51%) Gaps:8/142 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATR 77
            ::|:|. ||||||:.:||:|:::....:..|.| |.||.||  ....|......::.:::.|:..
Human    93 LEKNKQ-ILVLGLDGAGKTSVLHSLASNRVQHS-VAPTQGF--HAVCINTEDSQMEFLEIGGSKP 153

  Fly    78 YRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSS 142
            :|:.||........:|:|:||:|..|....|..|..::    ..|.::|::.:.||.|:|.:...
Human   154 FRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLI----AANPVLPLVVFANKQDLEAAYHI 214

  Fly   143 VKIAAALRLENI 154
            ..|..||.|..:
Human   215 TDIHEALALSEV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 39/136 (29%)
ARL9NP_001350723.1 Arl9_Arfrp2_like 98..263 CDD:133362 39/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.