DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl6 and arl6

DIOPT Version :9

Sequence 1:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster
Sequence 2:XP_031752440.1 Gene:arl6 / 100170493 XenbaseID:XB-GENE-940504 Length:193 Species:Xenopus tropicalis


Alignment Length:192 Identity:99/192 - (51%)
Similarity:138/192 - (71%) Gaps:2/192 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGMLHNLADLIKIKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGV 65
            ||:...||..:.:||.::.:|.|||:||||::|||..|.::.||..:|||:||.:|:|  ..|.:
 Frog     1 MGLFDKLAGWLGLKKKEVHVLCLGLDNSGKTTIINKLKPANAQTQDIVPTIGFSIEKF--KTSSL 63

  Fly    66 SIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFY 130
            |....||||..||||||||.:|....||:||||||::|.||.|:||:.:|.|.|:.:|.:|:||:
 Frog    64 SFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDKLRMVVAKEELETLLNHADIKHRRMPVLFF 128

  Fly   131 GNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMRFAMLNNKN 192
            .||||:.|||||||::..|.||:|||||||||:|..::||||.|||.||..|:..:..||::
 Frog   129 ANKMDLRDSLSSVKVSQLLSLEHIKDKPWHICASDGLTGEGLQEGVDWLQDQITQSNPNNED 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl6NP_611421.1 Arl6 19..182 CDD:206722 90/162 (56%)
arl6XP_031752440.1 Arl6 19..180 CDD:206722 90/162 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12960
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271528at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.