DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and RPL11A

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_015427.1 Gene:RPL11A / 856217 SGDID:S000006306 Length:174 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:129/169 - (76%)
Similarity:144/169 - (85%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHC 77
            |:||||||.|.||.|||.|||||||||||:||||||:||.||.||||||||:||||||||||||.
Yeast     5 AQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIRRNEKIAVHV 69

  Fly    78 TVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 142
            ||||.||||||||||||:||:||..|||:||||||||.|||||||||||||||:|:|||||:.||
Yeast    70 TVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRP 134

  Fly   143 GYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILN 181
            |..|..|||..||||..|:.||||.:.||:||||..:|:
Yeast   135 GARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 127/165 (77%)
RPL11ANP_015427.1 PTZ00156 2..172 CDD:185485 128/166 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343881
Domainoid 1 1.000 129 1.000 Domainoid score I1143
eggNOG 1 0.900 - - E1_COG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37376
Inparanoid 1 1.050 263 1.000 Inparanoid score I619
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60820
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 1 1.000 - - otm46489
orthoMCL 1 0.900 - - OOG6_100325
Panther 1 1.100 - - LDO PTHR11994
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1107
SonicParanoid 1 1.000 - - X1718
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.