DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and MRPL7

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_010523.3 Gene:MRPL7 / 851823 SGDID:S000002645 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:38/165 - (23%)
Similarity:69/165 - (41%) Gaps:43/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAVTKKIKR------------DPAKNP------MRDLH---------IRKLCLNICVGESGDR-- 37
            |||.|.:|:            .|.|||      :.|:|         :..:.:|..|.|:.:.  
Yeast    90 AAVVKGLKQRAWSGDSPYHLNRPPKNPRGSKAQLPDIHPIKWSNIPGLESVVINCFVREARENQL 154

  Fly    38 -LTRAAKVLEQLTG--QQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGL-----KV 94
             ...||..|:|:||  ..|:|||  ..|.::.:|:..::.....::|.:..:.|....     ::
Yeast   155 LAITAALQLQQITGCKPHPIFSK--NDVPTWKLRKGHQMGAKVELKGKEMSQFLSTLTEIVLPRI 217

  Fly    95 REYE-LRRENFSSTGNFGFGIQEHIDLGIKYDPSI 128
            |||: :..::.:..|...||:...   .||:.|.|
Yeast   218 REYKGISNQSGNRFGGISFGLTAE---DIKFFPEI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 31/140 (22%)
MRPL7NP_010523.3 Ribosomal_L5 133..186 CDD:395218 14/54 (26%)
Ribosomal_L5_C 191..287 CDD:395545 12/62 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100325
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.