DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and RPL16A

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_850376.2 Gene:RPL16A / 818874 AraportID:AT2G42740 Length:182 Species:Arabidopsis thaliana


Alignment Length:179 Identity:131/179 - (73%)
Similarity:147/179 - (82%) Gaps:5/179 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGI 67
            |..||:     .|||||:.::||.|||.|||||||||||:||||||:||.|||||||||||||||
plant     2 ASEKKL-----SNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGI 61

  Fly    68 RRNEKIAVHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYG 132
            |||||||.:.||||.||.::||.||||:||||.|.|||.||.||||||||||||||||||.||||
plant    62 RRNEKIACYVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYG 126

  Fly   133 LDFYVVLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILN 181
            :||||||.||||.|..|:|....||.|||:||:|||||||.||:|:|||
plant   127 MDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKYEGVILN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 126/165 (76%)
RPL16ANP_850376.2 PTZ00156 4..175 CDD:185485 128/175 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1393
eggNOG 1 0.900 - - E1_COG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37376
Inparanoid 1 1.050 263 1.000 Inparanoid score I959
OMA 1 1.010 - - QHG60820
OrthoDB 1 1.010 - - D1340833at2759
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 1 1.000 - - otm3132
orthoMCL 1 0.900 - - OOG6_100325
Panther 1 1.100 - - O PTHR11994
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1718
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.