DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and rpl11

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001016640.1 Gene:rpl11 / 549394 XenbaseID:XB-GENE-1000977 Length:177 Species:Xenopus tropicalis


Alignment Length:170 Identity:146/170 - (85%)
Similarity:159/170 - (93%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCT 78
            :||||:|.||||||||||||||||||||||||||||||.||||||||||||||||||||||||||
 Frog     8 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCT 72

  Fly    79 VRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPG 143
            |||||||||||:||||||||||:.|||.|||||||||||||||||||||||||||||||||||||
 Frog    73 VRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPG 137

  Fly   144 YNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILNTK 183
            :::..:|||.||:|.:||:.||:||:|||||||||||..|
 Frog   138 FSIADKKRKRGTIGAKHRIGKEEAMRWFQQKYDGIILPGK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 144/165 (87%)
rpl11NP_001016640.1 PTZ00156 4..174 CDD:185485 143/165 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3532
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37376
Inparanoid 1 1.050 294 1.000 Inparanoid score I2705
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1340833at2759
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 1 1.000 - - oto102275
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1718
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.