DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and Rpl11

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_006239286.1 Gene:Rpl11 / 362631 RGDID:1308681 Length:178 Species:Rattus norvegicus


Alignment Length:170 Identity:144/170 - (84%)
Similarity:160/170 - (94%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCT 78
            :||||:|.||||||||||||||||||||||||||||||.||||||||||||||||||||||||||
  Rat     9 ENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCT 73

  Fly    79 VRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPG 143
            |||||||||||:||||||||||:.|||.|||||||||||||||||||||||||||||||||||||
  Rat    74 VRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPG 138

  Fly   144 YNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILNTK 183
            :::..:||::|.:|.:||::||:||:|||||||||||..|
  Rat   139 FSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 142/165 (86%)
Rpl11XP_006239286.1 PTZ00156 5..175 CDD:185485 141/165 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340980
Domainoid 1 1.000 176 1.000 Domainoid score I3536
eggNOG 1 0.900 - - E1_COG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37376
Inparanoid 1 1.050 303 1.000 Inparanoid score I2587
OMA 1 1.010 - - QHG60820
OrthoDB 1 1.010 - - D1340833at2759
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 1 1.000 - - oto95536
orthoMCL 1 0.900 - - OOG6_100325
Panther 1 1.100 - - LDO PTHR11994
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1718
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.