DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and mrpl7

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_595713.1 Gene:mrpl7 / 2540459 PomBaseID:SPBC2F12.02c Length:287 Species:Schizosaccharomyces pombe


Alignment Length:121 Identity:28/121 - (23%)
Similarity:50/121 - (41%) Gaps:19/121 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAK--------AEEILERGLK 93
            :|.........:||.||....||..|..:.:|....:.|..|:.|..        :|.:|.   :
pombe   145 QLLSTMMAFRSITGLQPEIVYARKDVSPWKLRSGVPVGVKVTLTGESMYTFLSILSELVLP---Q 206

  Fly    94 VREYE-LRRENFSSTGNFGFGIQEHIDLGIKYDPSI-GIYGLDFYVVLGRPGYNVN 147
            :.::: |...:...|||..||:...:   :...|.| .:|.:..:.:   ||:|||
pombe   207 LHDFKGLSPTSGDQTGNISFGLPSEV---MPLFPQIEAVYEMYPHSL---PGFNVN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 28/121 (23%)
mrpl7NP_595713.1 RplE 81..280 CDD:223172 28/121 (23%)
Ribosomal_L5 125..176 CDD:278698 8/30 (27%)
Ribosomal_L5_C 181..277 CDD:279064 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0094
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100325
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.