DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and rpl1102

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_595899.1 Gene:rpl1102 / 2539846 PomBaseID:SPBC17G9.10 Length:174 Species:Schizosaccharomyces pombe


Alignment Length:170 Identity:124/170 - (72%)
Similarity:145/170 - (85%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAV 75
            :.|:|||::|.|.||.|||.:|||||||||||||||||:||.|||||||||:|.||||||||||.
pombe     3 EKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLSGQTPVFSKARYTIRRFGIRRNEKIAC 67

  Fly    76 HCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLG 140
            |.||||.||||||||||||:||||::.|||:||||||||||||||||||||||||||:|||||:.
pombe    68 HVTVRGPKAEEILERGLKVKEYELKKRNFSATGNFGFGIQEHIDLGIKYDPSIGIYGMDFYVVMD 132

  Fly   141 RPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIIL 180
            |||..|..||.:.|.||:.|::..||.:.||:||||.::|
pombe   133 RPGMRVARRKAQRGRVGYTHKINAEDTINWFKQKYDAVVL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 123/166 (74%)
rpl1102NP_595899.1 PTZ00156 2..173 CDD:185485 124/170 (73%)
Ribosomal_L5 13..60 CDD:278698 37/46 (80%)
Ribosomal_L5_C 65..141 CDD:279064 61/75 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 133 1.000 Domainoid score I1293
eggNOG 1 0.900 - - E1_COG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37376
Inparanoid 1 1.050 262 1.000 Inparanoid score I740
OMA 1 1.010 - - QHG60820
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 1 1.000 - - otm46984
orthoMCL 1 0.900 - - OOG6_100325
Panther 1 1.100 - - LDO PTHR11994
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1718
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.