DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL11 and rpl-11.2

DIOPT Version :9

Sequence 1:NP_001286614.1 Gene:RpL11 / 37235 FlyBaseID:FBgn0013325 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_508413.1 Gene:rpl-11.2 / 180535 WormBaseID:WBGene00004423 Length:196 Species:Caenorhabditis elegans


Alignment Length:177 Identity:136/177 - (76%)
Similarity:154/177 - (87%) Gaps:0/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNE 71
            :|:...|:|.||:|.|:||||||||||||||||||||||||||||.|||||||||||:|||||||
 Worm     9 EIREKKARNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRTFGIRRNE 73

  Fly    72 KIAVHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFY 136
            ||||||||||.|||||||:||||:||||.:||||.|||||||:||||||||||||||||||:|||
 Worm    74 KIAVHCTVRGPKAEEILEKGLKVKEYELYKENFSDTGNFGFGVQEHIDLGIKYDPSIGIYGMDFY 138

  Fly   137 VVLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILNTK 183
            |||.|.|..:..|:|..|.||..||:.:|:::||||||||||||..|
 Worm   139 VVLDRAGRRIAKRRRAPGRVGPSHRVEREESIKWFQQKYDGIILPPK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL11NP_001286614.1 PTZ00156 15..181 CDD:185485 132/165 (80%)
rpl-11.2NP_508413.1 PTZ00156 12..182 CDD:185485 132/169 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159459
Domainoid 1 1.000 152 1.000 Domainoid score I2645
eggNOG 1 0.900 - - E1_COG0094
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37376
Inparanoid 1 1.050 281 1.000 Inparanoid score I1753
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60820
OrthoDB 1 1.010 - - D1340833at2759
OrthoFinder 1 1.000 - - FOG0001460
OrthoInspector 1 1.000 - - otm14256
orthoMCL 1 0.900 - - OOG6_100325
Panther 1 1.100 - - LDO PTHR11994
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1107
SonicParanoid 1 1.000 - - X1718
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.