DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and CAPNS2

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_115706.1 Gene:CAPNS2 / 84290 HGNCID:16371 Length:248 Species:Homo sapiens


Alignment Length:296 Identity:82/296 - (27%)
Similarity:135/296 - (45%) Gaps:68/296 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 GEFIIRVFSETQNNMEENDDHVG--YGGKADTITPGFP---TPKPIDPQKEGLRRLFDSIAGKDM 612
            ||.:..:|.......|....::|  .||..:.|:....   ||:|...|:.     |.|:...:.
Human    16 GEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQH-----FTSVEASES 75

  Fly   613 EVDWMELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPF 677
            |    |::|.....                     ||.||| |...||..|::::          
Human    76 E----EVRRFRQQF---------------------TQLAGP-DMEVGATDLMNIL---------- 104

  Fly   678 EEQLGMNDQSNKRLIGDNPADGGPVTANAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETL 742
                      ||.|......            :|.|||.|.|||:|:::|:|.:||||||||:.|
Human   105 ----------NKVLSKHKDL------------KTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYL 147

  Fly   743 LSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMC 807
            .:.|.||:.::|.||.:::|.:...|||.||.:||:.||.::..::..||.:.||.:.|::||.|
Human   148 WNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISC 212

  Fly   808 AVKIKTYIDIFKERDTEKNETATFTLEEWIERTIYS 843
            .|::......||..|.:::.....:::||::.|:||
Human   213 LVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416 3/11 (27%)
EFh 719..765 CDD:238008 22/45 (49%)
CAPNS2NP_115706.1 EFh_PEF_CPNS1_2 80..248 CDD:320063 64/221 (29%)
EF-hand motif 80..108 CDD:320063 12/69 (17%)
EF-hand motif 122..152 CDD:320063 16/29 (55%)
EF-hand motif 153..183 CDD:320063 12/29 (41%)
EF-hand motif 189..217 CDD:320063 9/27 (33%)
EF-hand motif 218..248 CDD:320063 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.