DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and CAPNS1

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_005259352.1 Gene:CAPNS1 / 826 HGNCID:1481 Length:322 Species:Homo sapiens


Alignment Length:284 Identity:77/284 - (27%)
Similarity:108/284 - (38%) Gaps:99/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 GYGGKADTITPGFPT----------PKPIDP-------------QKEGLRRLFDSIAGKDMEVDW 616
            |.||.|..|..|..:          |:|..|             :....||||..:||.||||..
Human    53 GGGGTAMRILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSA 117

  Fly   617 MELKRILDHSMRDDLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQL 681
            .||..||:.          |..|.                             |.||        
Human   118 TELMNILNK----------VVTRH-----------------------------PDLK-------- 135

  Fly   682 GMNDQSNKRLIGDNPADGGPVTANAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEI 746
                                         |.||..|.||||||::|:|.:||||||||:.|.:.|
Human   136 -----------------------------TDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNI 171

  Fly   747 AKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKI 811
            .:|:||:|.:|.:.:|.:...:|..|..:||:|||..:.|::..||....|.:.||:||.|.|::
Human   172 KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRL 236

  Fly   812 KTYIDIFKERDTEKNETATFTLEE 835
            ......||..|.:........::|
Human   237 DAMFRAFKSLDKDGTGQIQVNIQE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 24/45 (53%)
CAPNS1XP_005259352.1 EFh_PEF_CPNS1_2 100..260 CDD:320063 67/235 (29%)
EF-hand motif 100..128 CDD:320063 14/37 (38%)
EF-hand motif 142..172 CDD:320063 18/29 (62%)
EF-hand motif 173..203 CDD:320063 9/29 (31%)
EF-hand motif 209..237 CDD:320063 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.