DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and AT2G27480

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_180317.3 Gene:AT2G27480 / 817293 AraportID:AT2G27480 Length:228 Species:Arabidopsis thaliana


Alignment Length:127 Identity:35/127 - (27%)
Similarity:64/127 - (50%) Gaps:5/127 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 GFSKDVCRSM--VAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNS 775
            |.|....|.:  :..:..|...:||.:|:..|.:.:|:|:|||..||.:.:|:::..|||:|..:
plant    88 GISNRTIRLLLFIYKIPVDSLLRLGPKEYVELWNCLAQWRAIFNRYDRDRSGKMNSTQLRDAFYN 152

  Fly   776 AGYHLNNRVLNVLGHRYGSRDGK---IAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLE 834
            .|..|...|..::..::....||   :.||.|:.|.:.:|...:.|:|.|......||.:.:
plant   153 LGCVLPTSVHQLIVSQFDDGTGKTVDLCFDSFLECGMIVKGLTEKFRENDPGYTGYATLSYD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 14/47 (30%)
AT2G27480NP_180317.3 EFh_PEF_Group_I 56..223 CDD:320055 35/127 (28%)
EF-hand motif 56..85 CDD:320055
EF-hand motif 93..124 CDD:320055 6/30 (20%)
EF-hand motif 125..154 CDD:320055 11/28 (39%)
EF-hand motif 161..192 CDD:320055 7/30 (23%)
EF-hand motif 193..223 CDD:320055 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3859
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.