DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and SRI

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_003121.1 Gene:SRI / 6717 HGNCID:11292 Length:198 Species:Homo sapiens


Alignment Length:264 Identity:71/264 - (26%)
Similarity:108/264 - (40%) Gaps:87/264 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 GYGGKADTITPGFPTPKPIDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVFNR 639
            ||||...  .|.|| .:..||    |...|.::||:|.::|..||:|.|..|             
Human    17 GYGGAPG--GPAFP-GQTQDP----LYGYFAAVAGQDGQIDADELQRCLTQS------------- 61

  Fly   640 FSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGPVTA 704
                               |..|                              |..|        
Human    62 -------------------GIAG------------------------------GYKP-------- 69

  Fly   705 NAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQL 769
                     |:.:.||.||:|||.|.||.:||.||:.|.:.:..|:..|..:|.:.:|.|...:|
Human    70 ---------FNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQEL 125

  Fly   770 REALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLE 834
            ::||.:.|:.|:.:.:|.:..|| |.:|||.|||:|.|.||::...|.|:.|||.:.....|..:
Human   126 QKALTTMGFRLSPQAVNSIAKRY-STNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYD 189

  Fly   835 EWIE 838
            ::|:
Human   190 DFIQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 19/45 (42%)
SRINP_003121.1 EFh_PEF_sorcin 34..198 CDD:320062 63/244 (26%)
EF-hand motif 34..62 CDD:320062 12/63 (19%)
EF-hand motif 74..103 CDD:320062 15/28 (54%)
EF-hand motif 104..133 CDD:320062 8/28 (29%)
EF-hand motif 140..167 CDD:320062 14/27 (52%)
EF-hand motif 169..197 CDD:320062 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.