DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and CAPN15

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_011520922.1 Gene:CAPN15 / 6650 HGNCID:11182 Length:1162 Species:Homo sapiens


Alignment Length:550 Identity:143/550 - (26%)
Similarity:213/550 - (38%) Gaps:151/550 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YETILNSCLASGSLFEDPLFPASNESLQF---SRRPDRHIEWLRPHEIAENPQFFVE---GYSRF 148
            :|.|:..|..:...|.|..||...||:.|   .....|..:||||.||  |...|.:   .:|.|
Human   542 WENIVAFCRENNVSFVDDSFPPGPESVGFPAGDSVQQRVRQWLRPQEI--NCSVFRDHRATWSVF 604

  Fly   149 ------DVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVII 207
                  |:.||.||:||.|:|.|.|.:..:|..||:.......|   |.:..|..:.|.|..|::
Human   605 HTLRPSDILQGLLGNCWFLSALAVLAERPDLVERVMVTRSLCAE---GAYQVRLCKDGTWTTVLV 666

  Fly   208 DDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL-- 270
            ||.||......:.....::.:.|.||:|||.|||||||.||:.|...|.:...||...|...|  
Human   667 DDMLPCDEAGCLLFSQAQRKQLWVALIEKALAKLHGSYFALQAGRAIEGLATLTGAPCESLALQL 731

  Fly   271 -----KEAPGNLFTILQK---AAERNSMMGCS-----IEPDPNVTEAETPQGLIRGHAYSITKVC 322
                 :|.|.:...|..|   :.|...:||.|     ::.|.:..|:   .||...|||||..| 
Human   732 SSTNPREEPVDTDLIWAKMLSSKEAGFLMGASCGGGNMKVDDSAYES---LGLRPRHAYSILDV- 792

  Fly   323 LIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQ 387
             .|:     || ..::|:||||| ...|||.|||..|.|   |...:.|:......:|.|||.:.
Human   793 -RDV-----QG-TRLLRLRNPWG-RFSWNGSWSDEWPHW---PGHLRGELMPHGSSEGVFWMEYG 846

  Fly   388 DFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTP------GVTAGGCRNFLDTFWHN 446
            ||:.:||.|:||.:..|             |:.:..:|.:..      ||||             
Human   847 DFVRYFDSVDICKVHSD-------------WQEARVQGCFPSSASAPVGVTA------------- 885

  Fly   447 PQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRELENRPQGLNFF 511
                :|:::        :.::..||.|:..|....:....|.:...:                  
Human   886 ----LTVLE--------RASLEFALFQEGSRRSDAVDSHLLDLCILV------------------ 920

  Fly   512 RYKSSVGRSPH------FINTREVCARF-----KLPPGHYLIVPSTFDPNEEGEFIIRVFSETQN 565
             ::::.|...|      ..:::....:|     .|.||.|.:|...|                  
Human   921 -FRATFGSGGHLSLGRLLAHSKRAVKKFVSCDVMLEPGEYAVVCCAF------------------ 966

  Fly   566 NMEENDDHVGYGGKADTITPGFPTPKPIDP 595
                  :|.|      ...||.|.|:...|
Human   967 ------NHWG------PPLPGTPAPQASSP 984

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042 110/322 (34%)
Calpain_III 418..565 CDD:279416 21/163 (13%)
EFh 719..765 CDD:238008
CAPN15XP_011520922.1 ZnF_RBZ 73..97 CDD:197784
RanBP2-type Zn finger 75..94 CDD:275376
RanBP2-type Zn finger 116..135 CDD:275376
RanBP2-type Zn finger 169..191 CDD:275375
ZnF_RBZ 213..237 CDD:197784
RanBP2-type Zn finger 215..234 CDD:275375
RanBP2-type Zn finger 412..431 CDD:275376
ZnF_RBZ 482..506 CDD:197784
RanBP2-type Zn finger 484..503 CDD:275376
CysPc 544..859 CDD:238004 112/334 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.