DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and capns1b

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001103176.1 Gene:capns1b / 560033 ZFINID:ZDB-GENE-030131-5206 Length:213 Species:Danio rerio


Alignment Length:275 Identity:74/275 - (26%)
Similarity:116/275 - (42%) Gaps:91/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 DTITPGFPTP--KPI--------DPQKEGLRRLFDSIAGKDMEVDWMELKRILDH--SMRDDLPK 633
            |...|..|.|  :|:        |.::: .|::|..:||.||||...||..||:.  |...||  
Zfish    18 DQFVPSDPPPPKRPLAYASHNETDEERQ-FRKVFQQLAGDDMEVSPKELMTILNKIISKHGDL-- 79

  Fly   634 PVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPAD 698
                                                                             
Zfish    80 ----------------------------------------------------------------- 79

  Fly   699 GGPVTANAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGR 763
                       :|.|||.:.||||||::|:|.:||||||||..|.:.|.:|:||:|.||.:::|.
Zfish    80 -----------KTDGFSIESCRSMVAVMDSDSTGKLGFEEFNYLWNNIKRWQAIYKTYDADHSGV 133

  Fly   764 VSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNET 828
            :...:|..|..:||:.||:::..::..||....|.:.||::|.|.|::......||..|.:.|.|
Zfish   134 IGSDELPGAFKAAGFPLNDQLFQLIVRRYSDEKGNMDFDNYIGCLVRLDAMCRAFKTLDKDNNGT 198

  Fly   829 ATFTLEEWIERTIYS 843
            ....::||::.|:||
Zfish   199 IKVDIQEWLQLTMYS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 25/45 (56%)
capns1bNP_001103176.1 EFh 89..139 CDD:298682 25/49 (51%)
EFh 120..209 CDD:298682 27/88 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.