DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and sri

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_005157918.1 Gene:sri / 393344 ZFINID:ZDB-GENE-040426-1356 Length:190 Species:Danio rerio


Alignment Length:270 Identity:70/270 - (25%)
Similarity:113/270 - (41%) Gaps:83/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 DHVGYGGKADTITPGFPTPKPIDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVV 636
            ::.|||  |.....|:|...| ..|::.|...|.:|||:|.::...||:..|             
Zfish     2 NYQGYG--APPAAGGYPGGFP-GQQQDPLYGYFTAIAGQDGQISAEELQACL------------- 50

  Fly   637 FNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGP 701
                       |||...|                                      |..|     
Zfish    51 -----------TQANFSG--------------------------------------GYRP----- 61

  Fly   702 VTANAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSG 766
                        |:.:.||.|::|||.|.|..:||.||:.|.:.:..||..|...|.:.:|.|..
Zfish    62 ------------FNLETCRLMISMLDRDMSYSMGFNEFKELWAVLNGWKQHFMSIDRDMSGTVDP 114

  Fly   767 FQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATF 831
            .::.:|::|.||.|:.:.:|.:..||.|: |||.|||::.|.||:::..|:|::||..:...|||
Zfish   115 QEMNQAISSMGYRLSPQAMNSIIKRYSSQ-GKITFDDYVACCVKLRSLTDVFRKRDQAQQGMATF 178

  Fly   832 TLEEWIERTI 841
            ..:::|..|:
Zfish   179 QYDDFIHCTM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 18/45 (40%)
sriXP_005157918.1 EFh 37..92 CDD:298682 24/133 (18%)
EFh 67..122 CDD:238008 20/54 (37%)
EFh 101..153 CDD:238008 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.