DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and clpr-2

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001309563.1 Gene:clpr-2 / 3565584 WormBaseID:WBGene00023410 Length:502 Species:Caenorhabditis elegans


Alignment Length:231 Identity:54/231 - (23%)
Similarity:90/231 - (38%) Gaps:42/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 GIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTC 254
            ||...|....|:|..:.||..:|:.:..........:.:.|:||::||:|||.|||..|.||...
 Worm     4 GIAQIRLLINGEWKVIKIDFHVPSSSASYEIFTPMVRKQAWAALIQKAFAKLGGSYAKLHGGFAD 68

  Fly   255 EAMEDFTGGVSEWYDLKE--APGNLFT-ILQKAAERNSMMGCSIEPDPNVTEAE--TPQGLIRGH 314
            .|....||..:..|.|.:  :..:::. ||.....:..:..||...:....|.:  ....:...|
 Worm    69 IAFLQLTGSFTSTYYLNKLSSDNDIWDFILSMQKSKFLVTACSTYCEEGSEEWDIFLKNQISPNH 133

  Fly   315 AYSI--TKVCLIDIVTPNRQG-KIPMIRMRNPWGNEAEWNGPWSDSSPE-------WRYIPE-EQ 368
            .|||  ||:         .:| ::.:|             |.::.|.|:       |.::|. ::
 Worm   134 GYSILDTKI---------HEGHRLVLI-------------GNFTYSLPDQGTGTLKWGHLPRFDE 176

  Fly   369 KAEIGLTFD----RDGEFWMSFQDFLNHFDRVEICN 400
            |...|..||    .....|:........|...|||:
 Worm   177 KCLCGNIFDYVLSTTSIHWVDLHILSRFFSCFEICH 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042 53/229 (23%)
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008
clpr-2NP_001309563.1 CysPc <2..212 CDD:381776 53/229 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.