DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and GCA

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_006712461.1 Gene:GCA / 25801 HGNCID:15990 Length:259 Species:Homo sapiens


Alignment Length:263 Identity:66/263 - (25%)
Similarity:103/263 - (39%) Gaps:92/263 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 GYGGKA--DTITPGFPTPKPIDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDLPKPVVF 637
            ||.|.|  ||.:..          .:.:...|.::||:|.|||..||:|.|..|           
Human    63 GYSGPAYSDTYSSA----------GDSVYTYFSAVAGQDGEVDAEELQRCLTQS----------- 106

  Fly   638 NRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGDNPADGGPV 702
                                                        |:|...:.             
Human   107 --------------------------------------------GINGTYSP------------- 114

  Fly   703 TANAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGF 767
                       ||.:.||.|:||||.|.:||:||..|:.|.:.:..||..|...|.:.:|.|...
Human   115 -----------FSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHH 168

  Fly   768 QLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFT 832
            :||:|:...||.|:.:.|..:..|| |::|:|.|||::.|.||::...|.|::||..:..:|.|.
Human   169 ELRQAIGLMGYRLSPQTLTTIVKRY-SKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFI 232

  Fly   833 LEE 835
            .::
Human   233 YDD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 19/45 (42%)
GCAXP_006712461.1 EFh 90..145 CDD:298682 27/133 (20%)
EFh 120..174 CDD:298682 22/53 (42%)
EF-hand_7 151..206 CDD:290234 20/55 (36%)
EFh 151..206 CDD:298682 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.