powered by:
Protein Alignment CalpA and Y77E11A.23
DIOPT Version :9
Sequence 1: | NP_001286613.1 |
Gene: | CalpA / 37232 |
FlyBaseID: | FBgn0012051 |
Length: | 843 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001294504.1 |
Gene: | Y77E11A.23 / 24105244 |
WormBaseID: | WBGene00235267 |
Length: | 167 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 17/60 - (28%) |
Similarity: | 26/60 - (43%) |
Gaps: | 4/60 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 AGQEFLNAAGEAAMGAAKDVVGSVINEIFIKKEADTKRVLPSIKNMRVQPLQSQSNSTLY 70
||..||.......:. :.|:.:|:::..:|........||..|. |.|..|.|:||.|
Worm 93 AGMYFLTTGNHFDLD--RSVIITVLHQCEMKHLHPEPCALPYYKT--VIPFNSTSSSTTY 148
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0045 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.