DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and clpr-1

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_493397.3 Gene:clpr-1 / 189180 WormBaseID:WBGene00012233 Length:252 Species:Caenorhabditis elegans


Alignment Length:236 Identity:56/236 - (23%)
Similarity:92/236 - (38%) Gaps:48/236 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGV 264
            |:|..:.||..||..:..........|.:.|.|.:||.:||:..|||.|.||....|::..||.:
 Worm    33 GEWKVLKIDFHLPQKSNSFERYAYMVKKQIWVAFIEKGFAKIRKSYEKLSGGVAGIALQQLTGAM 97

  Fly   265 S-----EWYDLKEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQ-----GLIRGHAYSIT 319
            :     |.::..|  ..::..:|:  .|||....::.......|:|..|     |:...|.||:.
 Worm    98 TFSVFMEKFNNDE--NRVWEFIQE--NRNSKFILTVSTPTIEEESEKKQLLEEYGIRDCHEYSVL 158

  Fly   320 KV------CLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDR 378
            ..      .||.:......||...:|.   ||:           .|.::.|.|:..| :.|.|..
 Worm   159 DAQVYMGHRLILLAGSGPFGKPKSVRR---WGH-----------LPSYKEIREDWCA-VDLGFSE 208

  Fly   379 DGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWE 419
            .|.||:...:...:|:.|.:|..             :.||:
 Worm   209 FGTFWIDMSELFQYFEYVTVC
QY-------------REKWK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042 53/215 (25%)
Calpain_III 418..565 CDD:279416 1/2 (50%)
EFh 719..765 CDD:238008
clpr-1NP_493397.3 CysPc <28..229 CDD:381776 53/214 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.