DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and clpr-3

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_492904.2 Gene:clpr-3 / 186784 WormBaseID:WBGene00010417 Length:308 Species:Caenorhabditis elegans


Alignment Length:228 Identity:55/228 - (24%)
Similarity:86/228 - (37%) Gaps:48/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GKWVDVIIDDRLPTYNGELMYMHSTEK------NEFWSALLEKAYAKLHGSYEALKGGSTCEAME 258
            |:|..:..|..||      |...|.|:      .:.|:|.:||.:|||.|||::|.......|..
 Worm    45 GEWKIIKTDFHLP------MNKQSIEEYAWMIGKQTWAAFIEKGFAKLFGSYKSLSAKPIDVAFR 103

  Fly   259 DFTGGVSEWYDLKEAPGNLFTILQKAAERN--SMMGCSIEPDPNVTEAE---TPQGLIRGHAYSI 318
            ..||..|:.|:|:... |...:.....|.:  ..:.|:.:...:...||   ...|:.:.|||:|
 Worm   104 KLTGAFSKNYELRSFK-NCDAVWDMIVEAHLAGFLLCTSKLSLDEESAEYIFNSTGIKQNHAYAI 167

  Fly   319 TKVCLIDIVTPNRQGKIPMIRMRN-----PWGN-EAEWN------GPWSDSSPEWRYIPEEQKAE 371
                |..:|..|.:    ::::.|     .|.. ..|||      ..:|...|...||....   
 Worm   168 ----LNSVVFENHR----LVQIGNTHACDKWKELHKEWNSLHYFYNKFSSKLPRRPYISHLD--- 221

  Fly   372 IGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPD 404
                   |..|||....:..||..:.:|....|
 Worm   222 -------DMSFWMDIDQYCEHFSSLTVCEYRKD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042 53/222 (24%)
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008
clpr-3NP_492904.2 CysPc <40..242 CDD:381776 53/221 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158982
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.