DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and clpr-3

DIOPT Version :10

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_492904.2 Gene:clpr-3 / 186784 WormBaseID:WBGene00010417 Length:308 Species:Caenorhabditis elegans


Alignment Length:228 Identity:55/228 - (24%)
Similarity:86/228 - (37%) Gaps:48/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GKWVDVIIDDRLPTYNGELMYMHSTEK------NEFWSALLEKAYAKLHGSYEALKGGSTCEAME 258
            |:|..:..|..||      |...|.|:      .:.|:|.:||.:|||.|||::|.......|..
 Worm    45 GEWKIIKTDFHLP------MNKQSIEEYAWMIGKQTWAAFIEKGFAKLFGSYKSLSAKPIDVAFR 103

  Fly   259 DFTGGVSEWYDLKEAPGNLFTILQKAAERN--SMMGCSIEPDPNVTEAE---TPQGLIRGHAYSI 318
            ..||..|:.|:|:... |...:.....|.:  ..:.|:.:...:...||   ...|:.:.|||:|
 Worm   104 KLTGAFSKNYELRSFK-NCDAVWDMIVEAHLAGFLLCTSKLSLDEESAEYIFNSTGIKQNHAYAI 167

  Fly   319 TKVCLIDIVTPNRQGKIPMIRMRN-----PWGN-EAEWN------GPWSDSSPEWRYIPEEQKAE 371
                |..:|..|.:    ::::.|     .|.. ..|||      ..:|...|...||....   
 Worm   168 ----LNSVVFENHR----LVQIGNTHACDKWKELHKEWNSLHYFYNKFSSKLPRRPYISHLD--- 221

  Fly   372 IGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPD 404
                   |..|||....:..||..:.:|....|
 Worm   222 -------DMSFWMDIDQYCEHFSSLTVCEYRKD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:459889 53/222 (24%)
Calpain_III 416..569 CDD:238132
EFh_PEF_CalpA_B 600..843 CDD:320071
EF-hand motif 600..627 CDD:320071
EF-hand motif 717..747 CDD:320071
EF-hand motif 748..778 CDD:320071
EF-hand motif 784..812 CDD:320071
EF-hand motif 813..843 CDD:320071
clpr-3NP_492904.2 CysPc <40..242 CDD:469591 53/221 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.