DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and clp-8

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_493327.2 Gene:clp-8 / 185746 WormBaseID:WBGene00009695 Length:646 Species:Caenorhabditis elegans


Alignment Length:372 Identity:95/372 - (25%)
Similarity:159/372 - (42%) Gaps:86/372 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NSTLYYG-NLGEKSSSLGPYSEVQDYETILNSCLASGSLFEDPLFPASNES-LQFSRRP------ 122
            |.|::.| :..||.::       :.:::||..|..|.|.|.|..||...:| :.|..:.      
 Worm    26 NWTIFLGDHENEKEAN-------EKFKSILEDCQRSKSAFIDKEFPHEPKSYMTFDEQSKVYGKY 83

  Fly   123 DRHIEWLRPH----------EIAE-----NPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESN 172
            :....||.|.          :::.     ||..|    :.::|.|.::|||.|:||.:.::.:..
 Worm    84 ESWKTWLFPKIWRRITPPSTDVSSSLSVYNPLTF----TAYEVFQRKVGDCGLVAALSAISTKPE 144

  Fly   173 LFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKA 237
            :...:.   .|.:.:..|::..:.:..|:|..:||||..| |..:.:.:.:|...:.|:||:|||
 Worm   145 VIMNIF---DSLQLSKYGVYKVKLFVDGQWKTIIIDDYFP-YTTDGIRIGATSGYQIWAALIEKA 205

  Fly   238 YAKLHGSYEALKGGSTCEAMEDFTGG------VSE--------WYDLKEAPGNLFTILQKAAERN 288
            ..|..|:|:.:.|..:..|....||.      |::        |..|.|...|.:.         
 Worm   206 LVKECGNYKGIHGFQSLSAFSALTGSPVLLIPVAKMFNNLRKYWKTLMEFRNNQYP--------- 261

  Fly   289 SMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGP 353
              |.|.       |......|::..|||:|     :|||  .|.|. .::.:|||.|... |...
 Worm   262 --MACG-------TLNREVNGILPQHAYTI-----MDIV--ERDGH-KLLLLRNPSGGSV-WTRN 308

  Fly   354 WSDSSPEWRYIPEEQKAEI-GLTFDRDGEFWMSFQDFLNHFDRVEIC 399
            |   |.||.:.||..|..: |:.   .|.||:|:.||||.|..:.:|
 Worm   309 W---SKEWEWWPENMKDLLEGMI---RGSFWISWDDFLNVFCSIYVC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042 85/333 (26%)
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008
clp-8NP_493327.2 CysPc 47..350 CDD:238004 90/344 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0045
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.