DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and B0563.7

DIOPT Version :10

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_509544.1 Gene:B0563.7 / 182041 WormBaseID:WBGene00015264 Length:229 Species:Caenorhabditis elegans


Alignment Length:96 Identity:22/96 - (22%)
Similarity:48/96 - (50%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   745 EIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNN-RVLNVLGHRYGSRDGKIAFDDFIMCA 808
            |:.:::.:|.::|.:.:|.:...:|::|:.|.|.|.|. .:.||:.......:|:|.|::|..|.
 Worm    49 ELKEYRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEVDADGNGEIDFEEFCACM 113

  Fly   809 VKIKTYI---------DIFKERDTEKNETAT 830
            .|.:..:         :.|:..|.::|...|
 Worm   114 KKSQNIVKSTNEELIRECFEIFDQDRNGIIT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:459889
Calpain_III 416..569 CDD:238132
EFh_PEF_CalpA_B 600..843 CDD:320071 22/96 (23%)
EF-hand motif 600..627 CDD:320071
EF-hand motif 717..747 CDD:320071 1/1 (100%)
EF-hand motif 748..778 CDD:320071 6/29 (21%)
EF-hand motif 784..812 CDD:320071 8/27 (30%)
EF-hand motif 813..843 CDD:320071 4/27 (15%)
B0563.7NP_509544.1 PTZ00184 46..183 CDD:185504 22/96 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.