DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and LOC101730581

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_031758232.1 Gene:LOC101730581 / 101730581 -ID:- Length:166 Species:Xenopus tropicalis


Alignment Length:183 Identity:84/183 - (45%)
Similarity:106/183 - (57%) Gaps:20/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QPLQSQSNSTLYYGNLGEKSSSLGPYSEVQDYETILNSCLASGSLFEDPLFPASNESLQFSRRPD 123
            ||..::.|...|.|               ||||.:...||.....|||..||||..||    .|.
 Frog     3 QPEGTKQNPKKYLG---------------QDYEQLRAQCLPPNPPFEDKEFPASQASL----GPK 48

  Fly   124 RH-IEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEEN 187
            :. ..||||.||..||:|...|.:|||:.|..|||||.|:....||........|:|.:|||:.|
 Frog    49 KQGFVWLRPSEIHPNPEFITSGATRFDICQQGLGDCWFLSPMGCLTLNKEYLSLVVPQDQSFKTN 113

  Fly   188 YAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAK 240
            |||||||||||.|.|.||::||:|||.:.:|:::.|.|:||||:||||||:||
 Frog   114 YAGIFHFRFWQRGDWTDVVVDDKLPTKDKKLVFVKSAEENEFWAALLEKAFAK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042 73/138 (53%)
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008
LOC101730581XP_031758232.1 CysPc 33..>166 CDD:412132 71/136 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D704215at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.