DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and LOC100495090

DIOPT Version :10

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_031755370.1 Gene:LOC100495090 / 100495090 XenbaseID:XB-GENE-29082559 Length:721 Species:Xenopus tropicalis


Alignment Length:61 Identity:18/61 - (29%)
Similarity:25/61 - (40%) Gaps:16/61 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GDNKS---QQESRSGDVVSGSYSLI---EPDGTQRVVEYT---------ADPVNGFNAVVH 105
            ||:.|   .||..:|. |..|:|.|   |....||..:.|         |..|:.|:.:.|
 Frog   163 GDHSSIIENQEFPTGK-VPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISH 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:459889 1/2 (50%)
Calpain_III 416..569 CDD:238132
EFh_PEF_CalpA_B 600..843 CDD:320071
EF-hand motif 600..627 CDD:320071
EF-hand motif 717..747 CDD:320071
EF-hand motif 748..778 CDD:320071
EF-hand motif 784..812 CDD:320071
EF-hand motif 813..843 CDD:320071
LOC100495090XP_031755370.1 Peptidase_C2 86..400 CDD:459889 18/61 (30%)
Calpain_III 432..546 CDD:460050
C2 574..681 CDD:472691
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.