DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CalpA and gca

DIOPT Version :9

Sequence 1:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster
Sequence 2:NP_001119547.1 Gene:gca / 100125139 XenbaseID:XB-GENE-983090 Length:203 Species:Xenopus tropicalis


Alignment Length:277 Identity:69/277 - (24%)
Similarity:114/277 - (41%) Gaps:90/277 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 GYGG----------KADTITPGFPTPKPIDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRD 629
            ||||          ...|:..|....:|...:.:.|...|.::||:|.|:|..||:|.|      
 Frog     5 GYGGYGNMNPHMQMMGQTMAQGGYFGQPQYHEGDPLWGYFRAVAGQDGEIDAEELQRCL------ 63

  Fly   630 DLPKPVVFNRFSNNMAFETQAAGPGDDGAGACGLLSLICGPFLKGTPFEEQLGMNDQSNKRLIGD 694
                              |||.               |.|.:   ||                  
 Frog    64 ------------------TQAG---------------IQGTY---TP------------------ 74

  Fly   695 NPADGGPVTANAIVDETHGFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVE 759
                               ||.:.||.::||||.|.:||:||.||:.:...::.||..|..:|.:
 Frog    75 -------------------FSLETCRVLIAMLDRDFTGKMGFSEFKEVWGALSAWKQNFCTFDQD 120

  Fly   760 NTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTE 824
            .:|.|...:|.:|:.:.||.|:...|:.:..|| |::|:|.|||::.|.||::...|:|:.||..
 Frog   121 RSGTVEPHELNQAIFAMGYRLSPPTLSTIVKRY-SKNGRIYFDDYVACCVKLRALTDVFRRRDGM 184

  Fly   825 KNETATFTLEEWIERTI 841
            :.....|..:::::.|:
 Frog   185 QQGFVNFIYDDFLQCTM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 18/45 (40%)
gcaNP_001119547.1 EFh_PEF_grancalcin 39..203 CDD:320061 62/243 (26%)
EF-hand motif 39..67 CDD:320061 13/51 (25%)
EF-hand motif 79..108 CDD:320061 13/28 (46%)
EF-hand motif 109..139 CDD:320061 8/29 (28%)
EF-hand motif 145..172 CDD:320061 12/27 (44%)
EF-hand motif 173..203 CDD:320061 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.