DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hts and fucA

DIOPT Version :9

Sequence 1:NP_001097377.2 Gene:hts / 37230 FlyBaseID:FBgn0263391 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_417280.1 Gene:fucA / 947282 ECOCYCID:EG10348 Length:215 Species:Escherichia coli


Alignment Length:195 Identity:44/195 - (22%)
Similarity:78/195 - (40%) Gaps:12/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFVLH 198
            |..||....::.|.   |:..|:.|.|:.|.::|.|.:..:|..|: .|:|..    ..|.:..|
E. coli    21 GLNQGTAGNVSVRY---QDGMLITPTGIPYEKLTESHIVFIDGNGK-HEEGKL----PSSEWRFH 77

  Fly   199 SVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVLG--EITTHAYTGLFDEEERNRLVR 261
            ...:.:|||....::.......|:|.|...:..:.......|  .|....| ..|...|.:..|.
E. coli    78 MAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNSIPCAPY-ATFGTRELSEHVA 141

  Fly   262 SLGPNSKVILLTNHGALCCGETIEEAFFAACHIVQACETQLKLLPVGLDNLVLIPEESRKAIYEQ 326
            ....|.|..||.:||.:.|...:|:|.:.|..:....:..|..|.: .|.:.::.:|....:.|:
E. coli   142 LALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQLYLTTLAI-TDPVPVLSDEEIAVVLEK 205

  Fly   327  326
            E. coli   206  205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htsNP_001097377.2 Aldolase_II 116..323 CDD:238232 43/190 (23%)
fucANP_417280.1 PRK08087 1..215 CDD:181226 44/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I747
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100477
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.