DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hts and Apip

DIOPT Version :9

Sequence 1:NP_001097377.2 Gene:hts / 37230 FlyBaseID:FBgn0263391 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_062709.3 Gene:Apip / 56369 MGIID:1926788 Length:241 Species:Mus musculus


Alignment Length:216 Identity:48/216 - (22%)
Similarity:78/216 - (36%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFV-L 197
            ||..|.|..|:  ||...|.::. |.|:....|....:...|:..|.:.....:....||... |
Mouse    38 GWVTGTGGGIS--LKHGNEIYIA-PSGVQKERIQPEDMFVCDINEQDISGPPASKKLKKSQCTPL 99

  Fly   198 HSVVHAARPDIRCAIYIGCSPVVAISS----LKTGLLP-----LTKDACVLG--EITTHAYTGLF 251
            ....:..|         |...|:...|    :.|.|.|     :|....:.|  :.|:..|....
Mouse   100 FMNAYTMR---------GAGAVIHTHSKAAVMATLLFPGQEFKITHQEMIKGIRKCTSGGYYRYD 155

  Fly   252 D-----------EEE--RNRLVRSLG--PNSKVILLTNHGALCCGETIEEA-FFAAC--HIVQAC 298
            |           ||:  :.|:..::.  |:|..:|:..||....|||.|:| ....|  ::....
Mouse   156 DMLVVPIIENTPEEKDLKERMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIA 220

  Fly   299 ETQLKL------LPVGLDNLV 313
            .:..|:      ||||.:.:|
Mouse   221 VSMKKMGLDPTQLPVGENGIV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htsNP_001097377.2 Aldolase_II 116..323 CDD:238232 48/216 (22%)
ApipNP_062709.3 salvage_mtnB 27..225 CDD:274521 42/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.