Sequence 1: | NP_001097377.2 | Gene: | hts / 37230 | FlyBaseID: | FBgn0263391 | Length: | 1833 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011518456.1 | Gene: | APIP / 51074 | HGNCID: | 17581 | Length: | 259 | Species: | Homo sapiens |
Alignment Length: | 216 | Identity: | 47/216 - (21%) |
---|---|---|---|
Similarity: | 80/216 - (37%) | Gaps: | 48/216 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 GWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFV-L 197
Fly 198 HSVVHAARPDIRCAIYIGCSPVVAISS----LKTGLLP-----LTKDACVLG--EITTHAYTGLF 251
Fly 252 D-----------EEE--RNRLVRSLG--PNSKVILLTNHGALCCGETIEEA-FFAAC--HIVQAC 298
Fly 299 ETQLKL------LPVGLDNLV 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hts | NP_001097377.2 | Aldolase_II | 116..323 | CDD:238232 | 47/216 (22%) |
APIP | XP_011518456.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0235 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |