DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hts and APIP

DIOPT Version :9

Sequence 1:NP_001097377.2 Gene:hts / 37230 FlyBaseID:FBgn0263391 Length:1833 Species:Drosophila melanogaster
Sequence 2:XP_011518456.1 Gene:APIP / 51074 HGNCID:17581 Length:259 Species:Homo sapiens


Alignment Length:216 Identity:47/216 - (21%)
Similarity:80/216 - (37%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GWTQGLGAQITARLKVDQEYFLVNPYGLLYHEITASALNKVDMQGQIVEQGTTNFGGNKSHFV-L 197
            ||..|.|..|:  ||...|.::. |.|:....|....:...|:..:.:...:.:....||... |
Human    56 GWVTGTGGGIS--LKHGDEIYIA-PSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTPL 117

  Fly   198 HSVVHAARPDIRCAIYIGCSPVVAISS----LKTGLLP-----LTKDACVLG--EITTHAYTGLF 251
            ....:..|         |...|:...|    :.|.|.|     :|....:.|  :.|:..|....
Human   118 FMNAYTMR---------GAGAVIHTHSKAAVMATLLFPGREFKITHQEMIKGIKKCTSGGYYRYD 173

  Fly   252 D-----------EEE--RNRLVRSLG--PNSKVILLTNHGALCCGETIEEA-FFAAC--HIVQAC 298
            |           ||:  ::|:..::.  |:|..:|:..||....|||.|:| ....|  ::....
Human   174 DMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDYLFDIA 238

  Fly   299 ETQLKL------LPVGLDNLV 313
            .:..|:      ||||.:.:|
Human   239 VSMKKVGLDPSQLPVGENGIV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htsNP_001097377.2 Aldolase_II 116..323 CDD:238232 47/216 (22%)
APIPXP_011518456.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.