DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hts and CG11134

DIOPT Version :9

Sequence 1:NP_001097377.2 Gene:hts / 37230 FlyBaseID:FBgn0263391 Length:1833 Species:Drosophila melanogaster
Sequence 2:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster


Alignment Length:240 Identity:48/240 - (20%)
Similarity:73/240 - (30%) Gaps:81/240 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GWTQGLGAQITARLKVDQEYFL---------VNPYGLLYHEITASALN-KVDMQGQIVEQGTTNF 188
            ||..|.|..::  :|.:.|.::         :.|..|...:||...|. ..:::|....|.|..|
  Fly    29 GWVTGTGGGMS--IKYNDEIYIAPSGVQKERMQPEDLFVQDITGKDLQLPPEIKGLKKSQCTPLF 91

  Fly   189 GGNKSHFVLHSVVHAARPDIRCAIYIGCSPVVAISSLKTGLLPLTKDACVLGEITTH--AYTGLF 251
            .....|....:|:|.....               :.:.|.|.|.....|      ||  ...|::
  Fly    92 MLAYQHRQAGAVIHTHSQH---------------AVMATLLWPGKTFRC------THLEMIKGVY 135

  Fly   252 DEEERNRL----------------VRSLG----------PNSKVILLTNHGALCCGETIEEAFFA 290
            ||.::..|                .|.|.          |....||:..||....|:..|:|   
  Fly   136 DEADKRYLRYDEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKA--- 197

  Fly   291 ACHIVQACETQLKLLPVGLDNLVLIPEESRKAIYEQSRRPPEDLE 335
                        |.:....|.|..|..|.:||..:     ||..|
  Fly   198 ------------KTMSECYDYLFSIAVEMKKAGID-----PEKFE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htsNP_001097377.2 Aldolase_II 116..323 CDD:238232 44/226 (19%)
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 43/224 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.